PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054566.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family TALE
Protein Properties Length: 384aa    MW: 43702.3 Da    PI: 6.7246
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054566.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-093113462055
                   HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
      Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                   +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  EcC054566.30 311 YKWPYPSETEKVALAESTGLDQKQINNWFINQRKRH 346
                   4679*****************************885 PP

2ELK37.84e-13266287122
           ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                   ELK++LlrKYsgyL+sLkqE+s
  EcC054566.30 266 ELKNHLLRKYSGYLSSLKQELS 287
                   9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.7E-21121165IPR005540KNOX1
PfamPF037901.1E-22122164IPR005540KNOX1
SMARTSM012563.5E-26172223IPR005541KNOX2
PfamPF037917.3E-23177221IPR005541KNOX2
PfamPF037892.7E-10266287IPR005539ELK domain
PROSITE profilePS5121311.296266286IPR005539ELK domain
SMARTSM011883.5E-7266287IPR005539ELK domain
PROSITE profilePS5007113.005286349IPR001356Homeobox domain
SuperFamilySSF466895.13E-20287362IPR009057Homeodomain-like
SMARTSM003898.8E-13288353IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-27291352IPR009057Homeodomain-like
CDDcd000862.16E-12298350No hitNo description
PfamPF059201.5E-16306345IPR008422Homeobox KN domain
PROSITE patternPS000270324347IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005975Biological Processcarbohydrate metabolic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009081Biological Processbranched-chain amino acid metabolic process
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0004084Molecular Functionbranched-chain-amino-acid transaminase activity
GO:0031176Molecular Functionendo-1,4-beta-xylanase activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MEEYGQMNEN SSTGSRGNNS FLYASPVLGP SSSGNSNYGR GNSSGGHFYS QSGDHCFQSE  60
APPHPVVKTE ATTSHHGHAQ KFHHYSLVRD HHDPSASHHH HHQHHQHQQL QTVSESSREV  120
DAMKAKIIAH PQYSNLLEAY MDCQKVGAPP EVVAKLSVAR QEFESRQRSS VASADGSKDP  180
ELDQFMEAYY DMLVKYRDEL TRPLQEAMDF MRRIETQLNL LSNNGPVRVF NSDEKCEGVG  240
SSEEDQDNSG GETELPEIDP RAEDRELKNH LLRKYSGYLS SLKQELSKKK KKGKLPKEAR  300
QKLLSWWELH YKWPYPSETE KVALAESTGL DQKQINNWFI NQRKRHWKPS EDMQFMVMDG  360
LHPQGAALYM DGHYIGDGPY RLGP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010059832.10.0PREDICTED: homeobox protein knotted-1-like 2
RefseqXP_010059833.10.0PREDICTED: homeobox protein knotted-1-like 2
SwissprotO041350.0KNAP2_MALDO; Homeobox protein knotted-1-like 2
TrEMBLA0A059BKP20.0A0A059BKP2_EUCGR; Uncharacterized protein
STRINGVIT_18s0001g08380.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-142KNOTTED-like from Arabidopsis thaliana